Scaffold FWIROz_GJ87FRN02FQG4L

Overview

Basic Information

• Taxon OID: 2124908006
• Scaffold ID: FWIROz_GJ87FRN02FQG4L
• Source Dataset Name: Soil microbial communities from sample at FACE Site Metagenome WIR_Oz2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 521
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Face And Otc Sites In Usa

Source Dataset Sampling Location

• Location Name: Wisconsin Rhinelander (WIR)
• Coordinates
  • Lat. (^o): 45.68
  • Long. (^o): -89.63

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017230	Metagenome / Metatranscriptome	242	Y

Sequences

Protein ID	Family	RBS	Sequence
FWIROz_08944440	F017230	N/A	ENAGMSCEKMAHWLEEFQKRVERERNSRIFDRLRASRKVHPLPDVGSGFGLFQEALDFRRIDSPHPTKIHDVPGELAKGDK