Basic Information | |
---|---|
Taxon OID | 2124908004 Open in IMG/M |
Scaffold ID | PBDC3_FISUTAU01DI46C Open in IMG/M |
Source Dataset Name | Poplar biomass bioreactor microbial communities from Brookhaven National Lab, NY - total biomass decay community |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 555 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Solid Waste → Wood → Composting → Bioreactor → Poplar Biomass Bioreactor → Poplar Biomass Bioreactor Microbial Communities From Brookhaven National Lab, Ny |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Upton, NY | |||||||
Coordinates | Lat. (o) | 40.869444 | Long. (o) | -72.886667 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F032176 | Metagenome / Metatranscriptome | 180 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
PBDC3_01601130 | F032176 | N/A | MFAWSAQLKGSGKAQGVNATVNVTAKSMTPPKGVAASKDKAMLFTMTGDMAVARGMDLMKMVPGENPSSVGLWTFMSMSDKLGWLNDVIAVVTFE |
⦗Top⦘ |