| Basic Information | |
|---|---|
| Taxon OID | 2124908004 Open in IMG/M |
| Scaffold ID | PBDC3_FIDWTPW02RMT7N Open in IMG/M |
| Source Dataset Name | Poplar biomass bioreactor microbial communities from Brookhaven National Lab, NY - total biomass decay community |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 511 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Solid Waste → Wood → Composting → Bioreactor → Poplar Biomass Bioreactor → Poplar Biomass Bioreactor Microbial Communities From Brookhaven National Lab, Ny |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Upton, NY | |||||||
| Coordinates | Lat. (o) | 40.869444 | Long. (o) | -72.886667 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001564 | Metagenome / Metatranscriptome | 670 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| PBDC3_06389320 | F001564 | GGA | VGEWPEKPSLHYLVHWALRREELCDPGLCPDAPEGGRCDHCPQDKLDAAQTSEAGLLIRRALELRAALNLGVHIGLDDIPANELYAMLILEEERDQLDRERANAERR |
| ⦗Top⦘ |