| Basic Information | |
|---|---|
| Taxon OID | 2119805012 Open in IMG/M |
| Scaffold ID | FNTS067_contig07751 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from sample at FACE Site NTS_067 Nevada Test Site |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 658 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → unclassified Nitrososphaera → Nitrososphaera sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Face And Otc Sites In Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Nevada, FACE Site NTS_067 Nevada Test Site | |||||||
| Coordinates | Lat. (o) | 36.766667 | Long. (o) | -115.95 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001042 | Metagenome / Metatranscriptome | 794 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| FNTS067_07499480 | F001042 | N/A | MSLKISEAGTDDKIVIDKLLVNKLTELLINSIYSVHVSRRSEIFLTSLDMHLADFSISNKNDIVCREFTEKSSLLLESYQKDVPKSLGKAESCLGEAIDLINLIVSASEAEANNG |
| ⦗Top⦘ |