| Basic Information | |
|---|---|
| Taxon OID | 2119805011 Open in IMG/M |
| Scaffold ID | FNTS010_GJ857YP01CM4QW Open in IMG/M |
| Source Dataset Name | Soil microbial communities from sample at Multiple FACE and OTC sites |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 512 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Face And Otc Sites In Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Sugar bunker, Nevada | |||||||
| Coordinates | Lat. (o) | 36.766667 | Long. (o) | -115.95 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F079702 | Metagenome | 115 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| FNTS010_03751720 | F079702 | N/A | KFPLAQSVSAQTAPADPIPTCEQLLSEFESDPRTQQASPEERQFVLAFLQTYVQGLLDEGVPGASRLDPDGNGIACDELRSAGGGQSASAGRASPRPSVDGGSQLLNRYGSLLEAGGPSSGPLPLMPNGGCPREFPTMRDGACYR |
| ⦗Top⦘ |