NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold FNTS007_GKN1E7E02IAJ6P

Scaffold FNTS007_GKN1E7E02IAJ6P


Overview

Basic Information
Taxon OID2119805009 Open in IMG/M
Scaffold IDFNTS007_GKN1E7E02IAJ6P Open in IMG/M
Source Dataset NameSoil microbial communities from sample at FACE Site NTS_007 Nevada Test Site
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)523
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Face And Otc Sites In Usa

Source Dataset Sampling Location
Location NameNevada Test Site FACE
CoordinatesLat. (o)36.766667Long. (o)-115.95Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009878Metagenome311Y

Sequences

Protein IDFamilyRBSSequence
FNTS007_01697950F009878GAGMTEISFAVKEVIPQEVCRLEVLAAEKAEAYGLQIGLKLKVVGGEHDGHAFMDYANRDEDTGEIKQDSKAWAVFEACLGRDFHKQSGVSLESLVGKQFVGQVTQTRTGSRNKVEFGTIGPVPSEALKEVKAPPKPDDSNDEDDVFNDLPF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.