Scaffold BSDYNP_contig04562__length_1523___numreads_51

Overview

Basic Information

• Taxon OID: 2119805007
• Scaffold ID: BSDYNP_contig04562__length_1523___numreads_51
• Source Dataset Name: Hot spring microbial communities from Beowulf Spring, Yellowstone National Park, Wyoming, USA - YNP_Beowulf Spring_D
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1523
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Candidatus Marsarchaeota → Candidatus Marsarchaeota group 2 → Candidatus Marsarchaeota G2 archaeon BE_D (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location

• Location Name: USA: Wyoming
• Coordinates
  • Lat. (^o): 44.733
  • Long. (^o): -110.709

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026924	Metagenome / Metatranscriptome	196	Y

Sequences

Protein ID	Family	RBS	Sequence
BSDYNP_00684320	F026924	AGGAGG	LSVSKVCWRQHYKFEASKIVHLGRHGFHIPVIVYGHDPDPEKAQEDLCINVVGFYEPIGSFRENQLILPPKKGERV