Scaffold ADL13m1u_contig03573__length_1181___numreads_18

Overview

Basic Information

• Taxon OID: 2100351014
• Scaffold ID: ADL13m1u_contig03573__length_1181___numreads_18
• Source Dataset Name: Hypersaline microbial communities from Antarctic Deep Lake - 13m 0.1um
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1181
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline → Hypersaline Microbial Communities From Antarctic Deep Lake

Source Dataset Sampling Location

• Location Name: Deep Lake Antarctica
• Coordinates
  • Lat. (^o): -68.54
  • Long. (^o): 78.18
  • Depth (m): 13

Associated Families

Family	Category	Number of Sequences	3D Structure?
F106195	Metagenome	100	N

Sequences

Protein ID	Family	RBS	Sequence
ADL13m1u_01073380	F106195	GAGG	MDLSTDFFAKIAVQLIIQLAILAFFAGTVIQKIKSISDKIDRLEEKQNKYNKLISRMFVVESKVEDIKDDIQEVKNE