NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold ADL13m1u_GQIGRQ001EE7ME

Scaffold ADL13m1u_GQIGRQ001EE7ME


Overview

Basic Information
Taxon OID2100351014 Open in IMG/M
Scaffold IDADL13m1u_GQIGRQ001EE7ME Open in IMG/M
Source Dataset NameHypersaline microbial communities from Antarctic Deep Lake - 13m 0.1um
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)528
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline → Hypersaline Microbial Communities From Antarctic Deep Lake

Source Dataset Sampling Location
Location NameDeep Lake Antarctica
CoordinatesLat. (o)-68.54Long. (o)78.18Alt. (m)Depth (m)13
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007954Metagenome342Y

Sequences

Protein IDFamilyRBSSequence
ADL13m1u_00293890F007954N/AFVTKAAKFGAASGVTVAVELEDGKVMTQRWGAVEATVEATVEASSEPSEPTPETIREAWTKIATDEWRKFQGMAAEYGLYRMKRPAMIDTLTDMGVMPGDNPWDTEQTVFDVPRTNSMVSSKAIAVADD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.