Scaffold ASMM170b_contig03170__length_779___numreads_8

Overview

Basic Information

• Taxon OID: 2100351011
• Scaffold ID: ASMM170b_contig03170__length_779___numreads_8
• Source Dataset Name: Marine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from medium methane PC12-240-170cm
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 779
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Coastal Water And Sediment → Coastal Water And Sediment Microbial Communities From Arctic Ocean, Off The Coast From Alaska

Source Dataset Sampling Location

• Location Name: Arctic Ocean
• Coordinates
  • Lat. (^o): 74.0678
  • Long. (^o): -145.54687

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023952	Metagenome / Metatranscriptome	208	N

Sequences

Protein ID	Family	RBS	Sequence
ASMM170b_00841020	F023952	N/A	QTKYILKVGGGRGVCDNTVGWGIVYKIYAGCSAVPALLLTLQARATYYENVTCTTATLDELENIQ