| Basic Information | |
|---|---|
| Taxon OID | 2100351011 Open in IMG/M |
| Scaffold ID | ASMM170b_GJFD58A01BCLDY Open in IMG/M |
| Source Dataset Name | Marine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from medium methane PC12-240-170cm |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 513 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Coastal Water And Sediment → Coastal Water And Sediment Microbial Communities From Arctic Ocean, Off The Coast From Alaska |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Arctic Ocean | |||||||
| Coordinates | Lat. (o) | 74.0678 | Long. (o) | -145.54687 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F069660 | Metagenome / Metatranscriptome | 123 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| ASMM170b_05323750 | F069660 | AGGTGG | MSSILKLLSIIAGIVPIILVLIKEFETPGFGAEKKKVILDSVASFYDAIAEGNTLPITKEKLLGLAGSFIDIAVAFFNVVGWFKHKNPTSVPRRFL |
| ⦗Top⦘ |