| Basic Information | |
|---|---|
| Taxon OID | 2100351008 Open in IMG/M |
| Scaffold ID | BSEYNP_contig04666__length_1416___numreads_33 Open in IMG/M |
| Source Dataset Name | Hot spring microbial communities from Beowulf Spring, Yellowstone National Park, Wyoming, USA - YNP_Beowulf Spring_E |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1416 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → Candidatus Nanoarchaeia → Nanoarchaeales → Nanopusillaceae → Candidatus Nanobsidianus → Candidatus Nanobsidianus stetteri | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Norris Geyser Basin, Yellowstone National Park | |||||||
| Coordinates | Lat. (o) | 44.733 | Long. (o) | -110.708917 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F090626 | Metagenome / Metatranscriptome | 108 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| BSEYNP_00911780 | F090626 | N/A | MSRIVKFENIYFGKNSLVKLFANKTHLENSTDYDGTALAFLLDISDFTNTDTLLSHFAIINGNEIRPILVEWNLRAIHGRLLLLLNLLPGPHDTKMLLKRFESTIENQRPETIKYIAGQYAKALTDAKGLKQIYNFLVQRIQQLKSIGIKKSEEEVRRLAEIYR |
| ⦗Top⦘ |