Scaffold BSEYNP_contig03843__length_1660___numreads_26

Overview

Basic Information

• Taxon OID: 2100351008
• Scaffold ID: BSEYNP_contig03843__length_1660___numreads_26
• Source Dataset Name: Hot spring microbial communities from Beowulf Spring, Yellowstone National Park, Wyoming, USA - YNP_Beowulf Spring_E
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1660
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location

• Location Name: Norris Geyser Basin, Yellowstone National Park
• Coordinates
  • Lat. (^o): 44.733
  • Long. (^o): -110.708917

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033507	Metagenome / Metatranscriptome	177	Y

Sequences

Protein ID	Family	RBS	Sequence
BSEYNP_01178970	F033507	N/A	MSVFPLFVFVVKSNIAEVVASTTSSVGTLTVNLSVTSGSGVTQIDGVYYLNPEANGYYTCGLQMNNQSVRYSWTLHVSATPTSLANGATVFVEVTYFDTYPGKPYYSETYPFTLNSNGQDSQEFSACMVPSTIFPESSVGVKVVGVKSATDQSIPYTSSGITIIPQ