Scaffold LWFCAn_contig07479

Overview

Basic Information

• Taxon OID: 2100351007
• Scaffold ID: LWFCAn_contig07479
• Source Dataset Name: Sediment microbial communities from Lake Washington, Seattle, for Methane and Nitrogen Cycles, sample from flow sorted aerobic plus nitrate
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 537
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment → Freshwater Sediment Microbial Communities From Lake Washington, Seattle, Usa, For Methane And Nitrogen Cycles

Source Dataset Sampling Location

• Location Name: Lake Washington, Seattle
• Coordinates
  • Lat. (^o): 47.676484
  • Long. (^o): -122.228394
  • Depth (m): 62

Associated Families

Family	Category	Number of Sequences	3D Structure?
F095140	Metagenome	105	Y

Sequences

Protein ID	Family	RBS	Sequence
LWFCAn_04495840	F095140	N/A	MNTKNLAGYGSIIMSLLTALAAAPYTLGEVATIIPPDWKAKVFVVSAIATLLLRVIRDNTTPPQPTP