Scaffold P3_DRAFT_NODE_72169_len_11340_cov_19_071693

Overview

Basic Information

• Taxon OID: 2088090008
• Scaffold ID: P3_DRAFT_NODE_72169_len_11340_cov_19_071693
• Source Dataset Name: Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 11390
• Total Scaffold Genes: 18
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 9 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil → Soil Microbial Communities From Permafrost In Bonanza Creek, Alaska

Source Dataset Sampling Location

• Location Name: Bonanza creek, Alaska, USA
• Coordinates
  • Lat. (^o): 64.7
  • Long. (^o): -148.3
  • Depth (m): .3 to .7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002096	Metagenome / Metatranscriptome	594	Y

Sequences

Protein ID	Family	RBS	Sequence
P3_DRAFT_01520850	F002096	AGG	MGFIVCLLLHRREREILVQGILPWGIDAVVFCWRCDRMRGRAVKVLQLNLSRQRY