Scaffold LWSO_GFMCQXZ02H7L13

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold LWSO_GFMCQXZ02H7L13

Scaffold LWSO_GFMCQXZ02H7L13

Overview

Basic Information
Taxon OID	2088090005 Open in IMG/M
Scaffold ID	LWSO_GFMCQXZ02H7L13 Open in IMG/M
Source Dataset Name	Sediment microbial communities from Lake Washington, Seattle, for Methane and Nitrogen Cycles, original sample replicate 1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	500
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment → Freshwater Sediment Microbial Communities From Lake Washington, Seattle, Usa, For Methane And Nitrogen Cycles

Source Dataset Sampling Location
Location Name	Lake Washington, Seattle
Coordinates	Lat. (^o)	47.052	Long. (^o)	-122.267889	Alt. (m)		Depth (m)	62
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019310	Metagenome / Metatranscriptome	230	Y

Sequences

Protein ID	Family	RBS	Sequence
LWSO_00492410	F019310	AGG	MSTLLEIEAAARTLPPDQKAELVRFLAAQLRSALPPLQKARLVCQGGDALLEAPPGAPPMTPENVKRLLEDW

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.