Scaffold P1_DRAFT_NODE_195543_len_632_cov_9_827532

Overview

Basic Information

• Taxon OID: 2088090004
• Scaffold ID: P1_DRAFT_NODE_195543_len_632_cov_9_827532
• Source Dataset Name: Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 682
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil → Soil Microbial Communities From Permafrost In Bonanza Creek, Alaska

Source Dataset Sampling Location

• Location Name: Bonanza creek, Alaska, USA
• Coordinates
  • Lat. (^o): 64.7
  • Long. (^o): -148.3
  • Depth (m): .3 to .7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013962	Metagenome / Metatranscriptome	267	Y

Sequences

Protein ID	Family	RBS	Sequence
P1_DRAFT_01194970	F013962	N/A	VAGXXXYESLRKRLCGQNETGTEAQGFMAGYVRDAAGRPVPRAHVWATWQILWVEQNGRLVSTNQQRTVETDSNSDGSYMMCGFTRNAQITAKVGMAGKNTVQEKLAFPANMVLEHDFQLGSR