Scaffold P1_DRAFT_NODE_19265_len_3919_cov_18_187548

Overview

Basic Information

• Taxon OID: 2088090004
• Scaffold ID: P1_DRAFT_NODE_19265_len_3919_cov_18_187548
• Source Dataset Name: Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3969
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (87.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil → Soil Microbial Communities From Permafrost In Bonanza Creek, Alaska

Source Dataset Sampling Location

• Location Name: Bonanza creek, Alaska, USA
• Coordinates
  • Lat. (^o): 64.7
  • Long. (^o): -148.3
  • Depth (m): .3 to .7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028886	Metagenome / Metatranscriptome	190	Y

Sequences

Protein ID	Family	RBS	Sequence
P1_DRAFT_00858760	F028886	GGAG	VLTCQSKTDIENINLMATLLSHHQALAYWQHLGRRFVADVEALLKRHLLQGILEVSWVHPATGERADDTQFFSALQELMAYAFEEYARLEKERRKQWWRRGTSDRPGILEEMQALLQHYRAELLAESGRLLQEGAT