| Basic Information | |
|---|---|
| Taxon OID | 2084038021 Open in IMG/M |
| Scaffold ID | ASA129_GJG7ZZE02GM8QF Open in IMG/M |
| Source Dataset Name | Marine sediment archaeal communities from Santa Barbara Basin, CA, that are methane-oxidizing, sample 9-12 cm |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 528 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Archaeal Communities From Santa Barbara Basin, Ca, That Are Anaerobic And Methane-Oxidizing |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Santa Barbara Basin | |||||||
| Coordinates | Lat. (o) | 34.21 | Long. (o) | -119.5 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F036102 | Metagenome / Metatranscriptome | 170 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| ASA129_01050640 | F036102 | AGGAGG | MDEQKMKELFRATANVQTPEGLAAYQAFAAALTIPILEKIELESIMRQLFTVEPLEPGAQASYPVAEDFEIPVWVLPGLGYIAQNFIEGIGEDVVVPTFT |
| ⦗Top⦘ |