Scaffold SPCE_L_FSPRUNR02I7L28

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold SPCE_L_FSPRUNR02I7L28

Scaffold SPCE_L_FSPRUNR02I7L28

Overview

Basic Information
Taxon OID	2084038016 Open in IMG/M
Scaffold ID	SPCE_L_FSPRUNR02I7L28 Open in IMG/M
Source Dataset Name	Soil microbial communities from Hopland, California, USA, that is PCE polluted - amended with lactate
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	GATC-Biotech AG, Konstanz, Germany
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	526
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Contaminated → Soil → Soil Microbial Community From Hopland, California, Usa, That Is Pce Polluted

Source Dataset Sampling Location
Location Name	Hopland, California, USA
Coordinates	Lat. (^o)	38.9727	Long. (^o)	-123.1145	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069405	Metagenome / Metatranscriptome	124	N

Sequences

Protein ID	Family	RBS	Sequence
SPCE_L_00040460	F069405	N/A	RPGHEPEGEQVRIRQIATAVVIVATVAIATPAQANVGTSCSAWKTTKTGGHQSACYVRSADWQVAAKGRGYYDGSTKLVQMNISVSLQSSIDGITWSTLVSRSCGFTAVPSSSPGGSCLTAAEWVDAGALYRARTFLVLFEANGTVRTTNPSYSPITS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.