Basic Information | |
---|---|
Taxon OID | 2084038016 Open in IMG/M |
Scaffold ID | SPCE_L_FSPRUNR02GSSLW Open in IMG/M |
Source Dataset Name | Soil microbial communities from Hopland, California, USA, that is PCE polluted - amended with lactate |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | GATC-Biotech AG, Konstanz, Germany |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 513 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Contaminated → Soil → Soil Microbial Community From Hopland, California, Usa, That Is Pce Polluted |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Hopland, California, USA | |||||||
Coordinates | Lat. (o) | 38.9727 | Long. (o) | -123.1145 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F023547 | Metagenome / Metatranscriptome | 209 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
SPCE_L_00000490 | F023547 | GAGG | MRRKHKAFEKKPVAPHEAAERVMEAASQPVSTEAPDQLPDRRMRGIDETAPERSEFERTMKDYYAQTDVEGQGGIPKEPPDEDPMPLQHLEKPKHPPAHN |
⦗Top⦘ |