Scaffold LWFCA_contig00620

Overview

Basic Information

• Taxon OID: 2084038009
• Scaffold ID: LWFCA_contig00620
• Source Dataset Name: Freshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - from flow sorted aerobic no nitrate
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1280
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment → Freshwater Sediment Microbial Communities From Lake Washington, Seattle, Usa, For Methane And Nitrogen Cycles

Source Dataset Sampling Location

• Location Name: Lake Washington, Seattle, Washington, USA
• Coordinates
  • Lat. (^o): 47.052
  • Long. (^o): -122.267889
  • Depth (m): 62

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015489	Metagenome / Metatranscriptome	254	Y

Sequences

Protein ID	Family	RBS	Sequence
LWFCA_00487740	F015489	N/A	MRPTCPHHCPGTVHLHGSYKRYADPEGSQEERIRRYLCSVCGLTLSVLPSHRLPYRPVRAERLQAYFDQRAGIQTKGLDPPPSIVEAGCLQRAWSALTARVTTLKEAFGQLMESKISEVASLWAGLRRASNSVPRMLCFLSEHHHISLLGNYRCLRPPA