Scaffold ASA120_GJFD58A02F8532

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold ASA120_GJFD58A02F8532

Scaffold ASA120_GJFD58A02F8532

Overview

Basic Information
Taxon OID	2077657018 Open in IMG/M
Scaffold ID	ASA120_GJFD58A02F8532 Open in IMG/M
Source Dataset Name	Marine sediment archaeal communities from Santa Barbara Basin, CA, that are methane-oxidizing, sample 0-3 cm
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	521
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Archaeal Communities From Santa Barbara Basin, Ca, That Are Anaerobic And Methane-Oxidizing

Source Dataset Sampling Location
Location Name	Santa Barbara Basin
Coordinates	Lat. (^o)	34.21	Long. (^o)	-119.5	Alt. (m)		Depth (m)	to .03
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085722	Metagenome	111	Y

Sequences

Protein ID	Family	RBS	Sequence
ASA120_04831110	F085722	N/A	MKMIRNAMAGVCYALLVIGLNGCSNPHKEAARASTESSKAEASVHNEKAKILEDYRKCLNKNKSNEKACESYKRALDTM

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.