Basic Information | |
---|---|
Taxon OID | 2077657000 Open in IMG/M |
Scaffold ID | ZODLETONE_B1_GLDH0LQ01B4C9D Open in IMG/M |
Source Dataset Name | Sulfur spring sediment and crust microbial communities from Zodletone, Oklahoma, USA - B1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Mogene LC |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 541 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Warm (34-42C) → Sediment → Sulfur Spring Sediment And Crust → Sulfur Spring Sediment And Crust Microbial Communities From Zodletone, Oklahoma, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Southwest Oklahoma | |||||||
Coordinates | Lat. (o) | 35.100293 | Long. (o) | -98.749601 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F037503 | Metagenome / Metatranscriptome | 168 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
ZODLETONE_00156660 | F037503 | N/A | MPLGAASWLSVIEVELPIGCEGFTTYQSLTNSECYNIYTGVRRWVLRSGAERERTQTIS |
⦗Top⦘ |