Scaffold prs_FIHLEPW02TLFSE

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold prs_FIHLEPW02TLFSE

Scaffold prs_FIHLEPW02TLFSE

Overview

Basic Information
Taxon OID	2070309004 Open in IMG/M
Scaffold ID	prs_FIHLEPW02TLFSE Open in IMG/M
Source Dataset Name	Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto Rico
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	528
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost → Green-Waste Compost Microbial Community At University Of California, Davis, Usa, From Solid State Bioreactor

Source Dataset Sampling Location
Location Name	Luquillo Rain Forest, Puerto Rico
Coordinates	Lat. (^o)	18.311389	Long. (^o)	-65.8375	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079451	Metagenome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
prs_03437050	F079451	AGGA	MSKGQWAFRPAVMTRAIKAAEKVGKVVIGTEIDSVTGKFELKFQTSGASPAETINEWDGA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.