| Basic Information | |
|---|---|
| Taxon OID | 2070309004 Open in IMG/M |
| Scaffold ID | prs_FIHLEPW02PYH4Q Open in IMG/M |
| Source Dataset Name | Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto Rico |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 502 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost → Green-Waste Compost Microbial Community At University Of California, Davis, Usa, From Solid State Bioreactor |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Luquillo Rain Forest, Puerto Rico | |||||||
| Coordinates | Lat. (o) | 18.311389 | Long. (o) | -65.8375 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F057585 | Metagenome / Metatranscriptome | 136 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| prs_00970760 | F057585 | GGA | MTPTTPVQDLATQWSFARKLYPIYFELAREFAIDVKPSAELEAGVETPGKDTVEQANRWLEHMDEAIQVHQLRQF |
| ⦗Top⦘ |