Scaffold prs_FHA1B5K04XQADN

Overview

Basic Information

• Taxon OID: 2070309004
• Scaffold ID: prs_FHA1B5K04XQADN
• Source Dataset Name: Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto Rico
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 528
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost → Green-Waste Compost Microbial Community At University Of California, Davis, Usa, From Solid State Bioreactor

Source Dataset Sampling Location

• Location Name: Luquillo Rain Forest, Puerto Rico
• Coordinates
  • Lat. (^o): 18.311389
  • Long. (^o): -65.8375

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011802	Metagenome	287	Y

Sequences

Protein ID	Family	RBS	Sequence
prs_07645180	F011802	N/A	QEPELQRYPARVEKFCSNFVIRKLMGDITVPFVEAVVDRMFNADEVTSVVDLVKLECLKGKIVSLFFTRRNLL