NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold prs_FHA1B5K04XF0EI

Scaffold prs_FHA1B5K04XF0EI


Overview

Basic Information
Taxon OID2070309004 Open in IMG/M
Scaffold IDprs_FHA1B5K04XF0EI Open in IMG/M
Source Dataset NameGreen-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto Rico
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)506
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost → Green-Waste Compost Microbial Community At University Of California, Davis, Usa, From Solid State Bioreactor

Source Dataset Sampling Location
Location NameLuquillo Rain Forest, Puerto Rico
CoordinatesLat. (o)18.311389Long. (o)-65.8375Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F089228Metagenome109N

Sequences

Protein IDFamilyRBSSequence
prs_04593710F089228N/AQATFTSNAPRYRDEYVPRYEPDQYGAWSGGPTQRVDARGYDRVYNSYGEPRFVPDARYLRRSRVVPRSPETLYSMQTGPPRREQYWGGGFFGGYRYGD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.