| Basic Information | |
|---|---|
| Taxon OID | 2067725009 Open in IMG/M |
| Scaffold ID | PermFrostAlaska_NODE_8767_len_5726_cov_23_502270 Open in IMG/M |
| Source Dataset Name | Permafrost microbial communities from central Alaska, USA - Permafrost field sample |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5776 |
| Total Scaffold Genes | 14 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost Microbial Communities From Central Alaska, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Alaska, USA | |||||||
| Coordinates | Lat. (o) | 65.7906 | Long. (o) | -149.9102 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F096256 | Metagenome | 105 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| draft_perm_00024990 | F096256 | N/A | LFFGYDKTADSWVVATAASGATIITQPXXXTQIKPKTYVGAYADAKGQKWNFTVELFSAENTSYNRYFELMKNKSDEGYIKTTESKIALGTGQTVFGRIDEKWYGYKASDSANPALYALFFGYDETAESWVVATAASGATIITQTTSALS |
| ⦗Top⦘ |