Scaffold PermFrostAlaska_NODE_24949_len_9431_cov_20_605238

Overview

Basic Information

• Taxon OID: 2067725009
• Scaffold ID: PermFrostAlaska_NODE_24949_len_9431_cov_20_605238
• Source Dataset Name: Permafrost microbial communities from central Alaska, USA - Permafrost field sample
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 9481
• Total Scaffold Genes: 12
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 8 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost Microbial Communities From Central Alaska, Usa

Source Dataset Sampling Location

• Location Name: Alaska, USA
• Coordinates
  • Lat. (^o): 65.7906
  • Long. (^o): -149.9102

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050314	Metagenome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
draft_perm_00053700	F050314	AGG	MSDMTHLVRPDLHVALDCPVDWTVMELDEQAGLRASNPTDPRVALQVTYDESSSALDEVSERLRNGLPKDALREPGTLRKGRVDADGQAHPDGPPVEALTFSARDGSFVYRVLVAEDAGHRWTVRLETLQRKEWWQESRTLERMLASLLLL