| Basic Information | |
|---|---|
| Taxon OID | 2067725009 Open in IMG/M |
| Scaffold ID | PermFrostAlaska_NODE_19238_len_1210_cov_25_718182 Open in IMG/M |
| Source Dataset Name | Permafrost microbial communities from central Alaska, USA - Permafrost field sample |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1260 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost Microbial Communities From Central Alaska, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Alaska, USA | |||||||
| Coordinates | Lat. (o) | 65.7906 | Long. (o) | -149.9102 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F064733 | Metagenome / Metatranscriptome | 128 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| draft_perm_00105990 | F064733 | AGG | MTITQTIYVELLDEGVVVYRPVEATPDPDGVLRLPATAPADEHG |
| ⦗Top⦘ |