| Basic Information | |
|---|---|
| Taxon OID | 2067725009 Open in IMG/M |
| Scaffold ID | PermFrostAlaska_NODE_13875_len_7936_cov_21_358494 Open in IMG/M |
| Source Dataset Name | Permafrost microbial communities from central Alaska, USA - Permafrost field sample |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 7986 |
| Total Scaffold Genes | 13 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 8 (61.54%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanomicrobiaceae → Methanoculleus → Methanoculleus sediminis | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost Microbial Communities From Central Alaska, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Alaska, USA | |||||||
| Coordinates | Lat. (o) | 65.7906 | Long. (o) | -149.9102 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F080207 | Metagenome | 115 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| draft_perm_00084460 | F080207 | GAG | MTVRKTSILLALCFVLIGTITPTTEVTATPTDDSAVQRFDIGIGDYKYGELTVDTLTDQFVANAHVGKQLADEQVTLVARNDGGQPALIAVARSTVNNGGRVHWEGTLTAAQLTWIHVYGDGAVFFVRGNY |
| ⦗Top⦘ |