Scaffold GPKC_F5V46DG01B674D

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GPKC_F5V46DG01B674D

Scaffold GPKC_F5V46DG01B674D

Overview

Basic Information
Taxon OID	2067725004 Open in IMG/M
Scaffold ID	GPKC_F5V46DG01B674D Open in IMG/M
Source Dataset Name	Soil microbial communities from Great Prairies - Kansas Corn soil
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	512
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location
Location Name	Kansas, USA
Coordinates	Lat. (^o)	39.211666	Long. (^o)	-96.594768	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059483	Metagenome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
GPKC_09055700	F059483	AGGA	MANVITSLKRTRSEEEHRCGVCGARFVPFEDSGSRILSVKAGDQETLTAILCGGCHSKWSAGATVTLKATPQAVP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.