| Basic Information | |
|---|---|
| Taxon OID | 2067725003 Open in IMG/M |
| Scaffold ID | GPWSG_F5G3JLY01DO5RS Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 501 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides iriomotensis | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Iowa, USA | |||||||
| Coordinates | Lat. (o) | 43.303333 | Long. (o) | -89.3325 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F085869 | Metagenome / Metatranscriptome | 111 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| GPWSG_01712570 | F085869 | N/A | DAVSGKGLLISKADSALRRAALIAVAITAFLLPAHAAFAATLELDGTIQTSPFIGSTVSMGDNEGSAFVPSDNSLWLAGDNKKEIYEVDPTTGALKRRIVRSVFNNAPMFGGGPPAGTDRTNDFEAIAYDRANDVLYVFSGNCCTSSILPTAFRLTRQSGQFQVES |
| ⦗Top⦘ |