Scaffold GPWSG_F5G3JLY01BD6J2

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GPWSG_F5G3JLY01BD6J2

Scaffold GPWSG_F5G3JLY01BD6J2

Overview

Basic Information
Taxon OID	2067725003 Open in IMG/M
Scaffold ID	GPWSG_F5G3JLY01BD6J2 Open in IMG/M
Source Dataset Name	Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	522
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location
Location Name	Iowa, USA
Coordinates	Lat. (^o)	43.303333	Long. (^o)	-89.3325	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049854	Metagenome / Metatranscriptome	146	Y

Sequences

Protein ID	Family	RBS	Sequence
GPWSG_01056720	F049854	N/A	VLGIVIFGDVIRSRRDAQAATGWLRTLAADLNEAIAGAERLAPFEFTQGDELQGLLAPGANPLTAILRGTLHPDARPMRWVVVAGEVDPGRGPAT

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.