| Basic Information | |
|---|---|
| Taxon OID | 2067725000 Open in IMG/M |
| Scaffold ID | GPWRP_F5MPXY302FLZJ8 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 510 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Wisconsin, USA | |||||||
| Coordinates | Lat. (o) | 43.303611 | Long. (o) | -89.332778 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000693 | Metagenome / Metatranscriptome | 933 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| GPWRP_01253630 | F000693 | GGA | VWGHKERDVTDQERQKAEELISRLEISVGQIFPRDGGNAGLITTMIQTLNGLRSLLGVVRPH |
| ⦗Top⦘ |