NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold rumenHiSeq_NODE_92195_len_12873_cov_0_695720

Scaffold rumenHiSeq_NODE_92195_len_12873_cov_0_695720


Overview

Basic Information
Taxon OID2061766007 Open in IMG/M
Scaffold IDrumenHiSeq_NODE_92195_len_12873_cov_0_695720 Open in IMG/M
Source Dataset NameBovine rumen microbial communities fromthe University of Illinois at Urbana-Champaign, USA, that are switchgrass associated - Sample 470
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12923
Total Scaffold Genes20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (25.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Bovine Rumen → Switchgrass-Associated Bovine Rumen Microbial Communities From Urbana, Illinois, Usa

Source Dataset Sampling Location
Location NameUniversity of Illinois at Urbana - Champaign, Illinois, USA
CoordinatesLat. (o)40.096Long. (o)-88.2315Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F090962Metagenome / Metatranscriptome108Y

Sequences

Protein IDFamilyRBSSequence
_HiSeq_25805430F090962N/ALSKIWAVYTDWIGFFFHSSGTWTTVWSILVIVWVVSLLIFLPLHRLSLKKVVKAKKALIDSVDKLIYLLSKAQYSLSEQQTLKYDPCFALMKTMFESGHFEYLDNLDTIKDNVKKVELLLKQRVISDAEWSKIDSQKSSLKFHTFWSKFFGYELNLVTL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.