| Basic Information | |
|---|---|
| Taxon OID | 2061766007 Open in IMG/M |
| Scaffold ID | rumenHiSeq_NODE_317020_len_2554_cov_0_474550 Open in IMG/M |
| Source Dataset Name | Bovine rumen microbial communities fromthe University of Illinois at Urbana-Champaign, USA, that are switchgrass associated - Sample 470 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2604 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Foregut → Rumen → Bovine Rumen → Switchgrass-Associated Bovine Rumen Microbial Communities From Urbana, Illinois, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | University of Illinois at Urbana - Champaign, Illinois, USA | |||||||
| Coordinates | Lat. (o) | 40.096 | Long. (o) | -88.2315 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F104224 | Metagenome / Metatranscriptome | 100 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| _HiSeq_05358260 | F104224 | N/A | VLEGNPGQEVSQNAPVVIQFNIAPHSECVIYLQKADEDSDIDLNSDLCFDYQPNILLEEQKFNSKKYRLRYNNKPVEIYECVTEHNTGIFFLYKNRDSELRVQVTAKFTKRNNLYLSIASSDXXXXXRKPNGEEFREEGGETVVITVEPGETGFFGLSAIDAFEKFSYTCQFDYLFSVAKVPAKFQQFKEEEGAEGGEGGEE |
| ⦗Top⦘ |