NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold rumenHiSeq_NODE_2460581_len_243054_cov_1_720433

Scaffold rumenHiSeq_NODE_2460581_len_243054_cov_1_720433


Overview

Basic Information
Taxon OID2061766007 Open in IMG/M
Scaffold IDrumenHiSeq_NODE_2460581_len_243054_cov_1_720433 Open in IMG/M
Source Dataset NameBovine rumen microbial communities fromthe University of Illinois at Urbana-Champaign, USA, that are switchgrass associated - Sample 470
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)243104
Total Scaffold Genes477 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)299 (62.68%)
Novel Protein Genes5 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales(Source: IMG-VR)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Bovine Rumen → Switchgrass-Associated Bovine Rumen Microbial Communities From Urbana, Illinois, Usa

Source Dataset Sampling Location
Location NameUniversity of Illinois at Urbana - Champaign, Illinois, USA
CoordinatesLat. (o)40.096Long. (o)-88.2315Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012184Metagenome / Metatranscriptome282Y
F017772Metagenome / Metatranscriptome238Y
F049349Metagenome / Metatranscriptome146Y
F076729Metagenome / Metatranscriptome117Y

Sequences

Protein IDFamilyRBSSequence
_HiSeq_26904590F076729N/AMNLTDNEVLKFQRGSPVFLEDICAVYPVKLGEIIDLGYDKF
_HiSeq_26905520F012184AGGAGGMNKNDVLSTILALEGATMCRQNKANFVAIPCEDGIVKVSVGTALAEDTKAHKAFNFEAASAEYKAWEAEAALRVAERANKPAKVKGPNPEAEARRQALDAQVAGLPSFTDYTATDILNALAGQVAENVTVMAIGSSAMRLVEKGVLTMTLDEKKKKHYTKA
_HiSeq_26906660F049349GAGGMDEFGCFYCWNPKKKQEKEQLYFFDAANNLKICDYCPKCGRKYGEVPTDE
_HiSeq_26906770F017772GAGGMNEPRLKILPPWTITIRKLEALFDGDPLIAFNCDYSEPAVVISCNNGDKVAALLQILPEEVDFGNVKLKVIVDGIPSNRAFTSKVELFETAFKGNPAFACAVCPAEEGYQWIGTTYVVFKNCVVQFAADNLNDCHGIISTLYQTIAEELLTGPATEGVFWNTDVERANLGYPLGEWP
_HiSeq_26908470F076729N/AMNLTDNEVLKFQKGGPVFIEDICAVYSVTLGEIVDIGYDKF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.