Scaffold GB_4MN_MetaGALL_nosff_rep_c118784

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GB_4MN_MetaGALL_nosff_rep_c118784

Scaffold GB_4MN_MetaGALL_nosff_rep_c118784

Overview

Basic Information
Taxon OID	2061766003 Open in IMG/M
Scaffold ID	GB_4MN_MetaGALL_nosff_rep_c118784 Open in IMG/M
Source Dataset Name	Hydrothermal vent microbial communities from Guaymas and Carmen Basins, Gulf of California, Sample 457
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Pennsylvania State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	512
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Hydrothermal Vent Microbial Communities From Guaymas And Carmen Basins, Gulf Of California

Source Dataset Sampling Location
Location Name	Gulf of California
Coordinates	Lat. (^o)	27.506	Long. (^o)	-111.347	Alt. (m)		Depth (m)	1996
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040325	Metagenome / Metatranscriptome	162	Y

Sequences

Protein ID	Family	RBS	Sequence
GB_4MN_00549330	F040325	N/A	MARRKIGNSHTTICVSWEDKELFRKFAKFVKTTRTGKLYESDAVLFSKILLFFKESNAVGDISNTTYPTKS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.