| Basic Information | |
|---|---|
| Taxon OID | 2061766000 Open in IMG/M |
| Scaffold ID | BDMC2_contig11542 Open in IMG/M |
| Source Dataset Name | Benzene-degrading bioreactor microbial communities from Toronto, Ontario, Canada, that are methanogenic - September 2009 gDNA_4 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1042 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioremediation → Hydrocarbon → Benzene → Bioreactor → Benzene-Degrading Bioreactor → Benzene-Degrading Bioreactor Microbial Communities From Toronto, Ontario, Canada, That Are Methanogenic |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Toronto, Ontario | |||||||
| Coordinates | Lat. (o) | 43.658712 | Long. (o) | -79.396003 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F050029 | Metagenome / Metatranscriptome | 146 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| BDMC2_01958250 | F050029 | AGGAGG | MATIVIHLKDKNLPPMEINDATYKGADSFIIKITSNGNEYWFNWNEC |
| ⦗Top⦘ |