Scaffold BDMC2_GGZN10813_g1

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold BDMC2_GGZN10813_g1

Scaffold BDMC2_GGZN10813_g1

Overview

Basic Information
Taxon OID	2061766000 Open in IMG/M
Scaffold ID	BDMC2_GGZN10813_g1 Open in IMG/M
Source Dataset Name	Benzene-degrading bioreactor microbial communities from Toronto, Ontario, Canada, that are methanogenic - September 2009 gDNA_4
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	760
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioremediation → Hydrocarbon → Benzene → Bioreactor → Benzene-Degrading Bioreactor → Benzene-Degrading Bioreactor Microbial Communities From Toronto, Ontario, Canada, That Are Methanogenic

Source Dataset Sampling Location
Location Name	Toronto, Ontario
Coordinates	Lat. (^o)	43.658712	Long. (^o)	-79.396003	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081504	Metagenome	114	Y

Sequences

Protein ID	Family	RBS	Sequence
BDMC2_00523310	F081504	AGGAGG	MPICVKCGSQAAYWTIIDKENNSKDYCDSCFKKYDLAKVKKEMDEYQRKRKENKTRC

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.