Scaffold GBSWBV_contig01352

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GBSWBV_contig01352

Scaffold GBSWBV_contig01352

Overview

Basic Information
Taxon OID	2058419004 Open in IMG/M
Scaffold ID	GBSWBV_contig01352 Open in IMG/M
Source Dataset Name	Hot spring viral communities from Great Boiling Spring, Nevada -
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1620
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Unclassified → Unclassified → Hot Spring → Hot Spring Microbial Communities From Great Boiling Spring, Nevada

Source Dataset Sampling Location
Location Name	Great Boiling Spring, Nevada
Coordinates	Lat. (^o)	40.65833	Long. (^o)	-119.37772	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F104050	Metagenome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
GBSWBV_00405520	F104050	GAGG	VSEAKKCIIRLRKTCVVFESLVDEERQKYGTKEFVVTYCSMCIKTYYAKAKHKLVNKFSVVNTL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.