Scaffold mhc9b_MHC9B_contig09749

Overview

Basic Information

• Taxon OID: 2051223005
• Scaffold ID: mhc9b_MHC9B_contig09749
• Source Dataset Name: Human fecal microbial communities from Orebro University Hospital, Sweden - Sample 10373
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Maryland School of Medicine
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3562
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae → Collinsella → unclassified Collinsella → Collinsella sp. (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Orebro University Hospital, Sweden, Of Individuals With Crohns Disease

Source Dataset Sampling Location

• Location Name: Orebro University Hospital, Sweden
• Coordinates
  • Lat. (^o): 59.274717
  • Long. (^o): 15.230656

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099269	Metagenome	103	N

Sequences

Protein ID	Family	RBS	Sequence
MHC9B_contig09749_metagene_gene_3	F099269	N/A	LPTHAKGGLRGDAEASFFVHGVLLSVQVGELLLLDDLGDRAGGASVLASATGDAGILVSDGGDVLELQNASGAGVDANATSDALVGINYGMSHGSFLSVDRRYRRCAPV