| Basic Information | |
|---|---|
| Taxon OID | 2051223005 Open in IMG/M |
| Scaffold ID | mhc9b_MHC9B_contig03086 Open in IMG/M |
| Source Dataset Name | Human fecal microbial communities from Orebro University Hospital, Sweden - Sample 10373 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Maryland School of Medicine |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1273 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Orebro University Hospital, Sweden, Of Individuals With Crohns Disease |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Orebro University Hospital, Sweden | |||||||
| Coordinates | Lat. (o) | 59.274717 | Long. (o) | 15.230656 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F080673 | Metagenome | 115 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| MHC9B_contig03086_metagene_gene_3 | F080673 | N/A | MDEIMKLQDEALLYLRDNITKDEAYYILTTDKDMIEILIANKKDGSKRIKVLDVEYTIEKDDMLFLFDTDGVIDECLLVASYIGVNMYFRRQDVNAILNNINREEVMKYPYIAIQLDNIQTVEKRRVVFEITGHRMDDNKERIDFMFVYFMARML |
| ⦗Top⦘ |