Scaffold LWAeNNiSIP_GDP3C2T02J33FC

Overview

Basic Information

• Taxon OID: 2046860007
• Scaffold ID: LWAeNNiSIP_GDP3C2T02J33FC
• Source Dataset Name: Freshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - Microc enrich af exp to meth lab w 13Ccarbon-no added nitrate
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 521
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment → Freshwater Sediment Microbial Communities From Lake Washington, Seattle, Usa, For Methane And Nitrogen Cycles

Source Dataset Sampling Location

• Location Name: Lake Washington, Seattle, Washington, USA
• Coordinates
  • Lat. (^o): 47.07
  • Long. (^o): -122.27889
  • Depth (m): 62

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055309	Metagenome	139	Y

Sequences

Protein ID	Family	RBS	Sequence
LWAeNNiSIP_74140	F055309	N/A	RNREEVLRIFKKWCLLTRDMISLNRADPVAKARHRQIDAPVGPLSDIHSLQYANNVRHILTVNSLQTLKPPRNQRINPQSRSAPEAV