| Basic Information | |
|---|---|
| Taxon OID | 2046860001 Open in IMG/M |
| Scaffold ID | MiccSOB_F3TY2AH01ATZ1Z Open in IMG/M |
| Source Dataset Name | Concrete drainage pipe biofilm microbial communities from Ohio, US - sample 12382 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | 454 Life Sciences |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 505 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Storm Water → Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm Microbial Communities From Ohio, Us |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Ohio, USA | |||||||
| Coordinates | Lat. (o) | 39.8 | Long. (o) | -84.3 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002967 | Metagenome / Metatranscriptome | 517 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| MiccSOB_9867890 | F002967 | GAGG | VSTTVWLSPSATSFACLCETCLEAARTGGALFADALRAASVRGNVDADAPRSIVRCGAGHEIVLQRGERPPGLSRRDERQLQLT |
| ⦗Top⦘ |