| Basic Information | |
|---|---|
| Taxon OID | 2044078019 Open in IMG/M |
| Scaffold ID | MiccSRB_F31IBB102JBSEO Open in IMG/M |
| Source Dataset Name | Concrete drainage pipe biofilm microbial communities from Ohio, US, sample, 12383 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | 454 Life Sciences |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 509 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Storm Water → Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm Microbial Communities From Ohio, Us |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Ohio | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026170 | Metagenome | 199 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| MiccSRB11314630 | F026170 | N/A | EQRSDEEQKAVETNLRALAHRLQRLRDEAAMQALRGETDPGVEKGLDMALRELNGLLRAGSG |
| ⦗Top⦘ |