| Basic Information | |
|---|---|
| Taxon OID | 2044078019 Open in IMG/M |
| Scaffold ID | MiccSRB_F31IBB102FSYUI Open in IMG/M |
| Source Dataset Name | Concrete drainage pipe biofilm microbial communities from Ohio, US, sample, 12383 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | 454 Life Sciences |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 507 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → unclassified Azorhizobium → Azorhizobium sp. 32-67-21 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Storm Water → Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm Microbial Communities From Ohio, Us |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Ohio | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F018415 | Metagenome / Metatranscriptome | 235 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| MiccSRB8906300 | F018415 | N/A | EYLYLGLQDKSYLIPAPNPGSPSDRVHLDDHSVRVGVNYKLPWSLLDIFYKR |
| ⦗Top⦘ |