| Basic Information | |
|---|---|
| Taxon OID | 2044078014 Open in IMG/M |
| Scaffold ID | ANME2c_2_ANME2c_2025433 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial communities from the Eel River Basin, Pacific Ocean, containing methane-oxidizing consortia - ANME2c_2rp |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | 454 Life Sciences, Pennsylvania State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 511 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Neritic Zone → Sediment → Marine Sediment → Marine Sediment Microbial Communities From The Eel River Basin, Pacific Ocean, Containing Methane-Oxidizing Consortia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Eel River Basin, California, USA | |||||||
| Coordinates | Lat. (o) | 40.74703 | Long. (o) | -123.869505 | Alt. (m) | Depth (m) | 500 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F054877 | Metagenome / Metatranscriptome | 139 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| ANME2c_2_722560 | F054877 | AGGAG | MKPIKNLRVLARFSPKTTDDLEPELSNLVGTEAVFSYHRYVDADDTPYSEQWVLTAEDQRFGDYWFPECDLEVLQEMHSA |
| ⦗Top⦘ |